Netrin 4 (NTN4) Rabbit Polyclonal Antibody TA338467 from OriGene Technologies | Biocompare.com

Supplier Images

Netrin 4 (NTN4) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Netrin 4 (NTN4) Rabbit Polyclonal Antibody

OriGene Technologies' Netrin 4 (NTN4) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunocytochemistry, Immunofluorescence, and Western Blot. The Netrin 4 (NTN4) Rabbit Polyclonal Antibody was generated using NTN4 as the antigen and it reacts with Human, Mouse, and Rat.

Description

Rabbit Polyclonal Anti-NTN4 Antibody

Product Specs
ItemNetrin 4 (NTN4) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA338467
Quantity100 µl
ApplicationsIF, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Mouse, Rat
TargetNTN4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
NCBI Full Gene Namenetrin 4
NCBI Gene AliasesPRO3091
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!